Welcome to YULA Electronics
CAD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover

Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover

Product Code: 8005
Brand: Dell
Product Condition: Used
weight: 800.0g
$80.00 inc. tax
 Add to Cart
Description
Used. Tested as working. Minor scratches as it's in used condition. Comes as pictured
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i