Welcome to YULA Electronics
CAD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover
Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover

Dell XPS 13 9365 2-in-1 Palmrest Keyboard TouchPad Bottom Case Cover

Product Code: 8005
Brand: Dell
Product Condition: Used
weight: 800.0g
$80.00 inc. tax
 Add to Cart
Description
Used. Tested as working. Minor scratches as it's in used condition. Comes as pictured
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i