Welcome to YULA Electronics
CAD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Battery For Apple MacBook Pro 13 inch A1278
Battery For Apple MacBook Pro 13 inch A1278
Battery For Apple MacBook Pro 13 inch A1278
Notify me when product is back in stock

Battery For Apple MacBook Pro 13 inch A1278

Product Code: 2001
Product Condition: New
weight: 350.0g
$50.00 inc. tax
 Add to Cart
Description
Battery For Apple MacBook Pro 13 inch A1278

A1278: This item is only fit for Apple A1278 (Mid 2009/Mid 2010/Early 2011/Late 2011/Mid 2012),
Please confirm your laptop version before you order it .

Compatibel Model:

All Mid 2009 13" Unibody MacBook Pro

All Mid 2010 13" Unibody MacBook Pro

All Early 2011 13" Unibody MacBook Pro

All Late 2011 13" Unibody MacBook Pro

All Mid 2012 13" Unibody MacBook Pro

For Apple MacBook Pro 13" A1278 (2009 Version)
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i